Product Description
Size: 20ul / 150ul
The ATG12 (30505-1-AP) by Proteintech is a Polyclonal antibody targeting ATG12 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples
30505-1-AP targets ATG12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HeLa cells, COLO 320 cells, NIH/3T3 cells, PC-3 cells
Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: PC-3 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:250-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
ATG12, also named as APG12 and APG12L, belongs to the ATG12 family. It is required for autophagy. Free ATG12 is 15kd or 8kd. Conjugated to ATG5, ATG12-ATG5 show 48-55kd.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag32268 Product name: Recombinant human ATG12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 48-187 aa of BC012266 Sequence: MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG Predict reactive species
Full Name: ATG12 autophagy related 12 homolog (S. cerevisiae)
Calculated Molecular Weight: 15 kDa
Observed Molecular Weight: 20 kDa, 50-60 kDa
GenBank Accession Number: BC012266
Gene Symbol: ATG12
Gene ID (NCBI): 9140
RRID: AB_3086340
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O94817
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924