Proteintech, 30529-1-AP, C16orf75 Polyclonal antibody

Size: 20ul / 150ul The C16orf75 (30529-1-AP) by Proteintech is a Polyclonal antibody targeting C16orf75 in WB, IF/ICC, ELISA applications with reactivity to human samples 30529-1-AP targets C16orf75 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-1080 cells, HeLa cells, MCF-7 cells, U-251 cells Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information C16orf75 is also named as BLM-associated protein of 18 kDa (BLAP18), RMI2, hRMI2 and RecQ-mediated genome instability protein 2. C16orf75 is essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates. It is required to regulate sister chromatid segregation and to limit DNA crossover. And RMI2 is essential for the stability, localization, and function of BLM, TOP3A, and complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM (PMID: 18923082, PMID: 18923083, PMID: 27977684). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32880 Product name: Recombinant human C16orf75 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 99-147 aa of BC031016 Sequence: GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP Predict reactive species Full Name: chromosome 16 open reading frame 75 Observed Molecular Weight: 19 kDa GenBank Accession Number: BC031016 Gene Symbol: C16orf75 Gene ID (NCBI): 116028 RRID: AB_3086351 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96E14 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.