Iright
BRAND / VENDOR: Proteintech

Proteintech, 30530-1-AP, IDO2 Polyclonal antibody

CATALOG NUMBER: 30530-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IDO2 (30530-1-AP) by Proteintech is a Polyclonal antibody targeting IDO2 in WB, ELISA applications with reactivity to Human, mouse, rat samples 30530-1-AP targets IDO2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information IDO2 is one of two closely related tryptophan catabolizing enzymes induced under inflammatory conditions. In contrast to the immunoregulatory role defined for IDO1 in cancer models, IDO2 has a proinflammatory function in models of autoimmunity and contact hypersensitivity. The product of the IDO2 gene is a 420 amino-acid protein, with a molecular weight of ~47 kDa. (PMID: 34965962, PMID: 29807576, PMID: 35493480) Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33013 Product name: Recombinant human IDO2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 268-420 aa of NM_194294 Sequence: GVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSKESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCVQALAELRSYHITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG Predict reactive species Full Name: indoleamine 2,3-dioxygenase 2 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 40-47 kDa GenBank Accession Number: NM_194294 Gene Symbol: IDO2 Gene ID (NCBI): 169355 RRID: AB_3086352 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZQW0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924