Proteintech, 30545-1-AP, MTA1 Polyclonal antibody

Size: 20ul / 150ul The MTA1 (30545-1-AP) by Proteintech is a Polyclonal antibody targeting MTA1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30545-1-AP targets MTA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, NIH/3T3 cells, HEK-293T cells, MCF-7 cells Positive IHC detected in: human prostate cancer tissue, human skin cancer tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Metastasis-associated protein 1 (MTA1) is a member of the MTA family which is involved in regulating DNA-based biological processes (PMID: 25332144). MTA1 is an integral part of nucleosome remodeling histone deacetylase complex (NuRD complex) and regulates nucleosome remodeling and deacetylation by stabilizing the NuRD complex and related proteins(PMID: 12419236). MTA1 expression is associated with tumor malignancy in several cancer. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30994 Product name: Recombinant human MTA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 513-678 aa of NM_004689 Sequence: TARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETK Predict reactive species Full Name: metastasis associated 1 Calculated Molecular Weight: 81 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: NM_004689 Gene Symbol: MTA1 Gene ID (NCBI): 9112 RRID: AB_3086358 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13330 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.