Iright
BRAND / VENDOR: Proteintech

Proteintech, 30560-1-AP, PGLS Polyclonal antibody

CATALOG NUMBER: 30560-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PGLS (30560-1-AP) by Proteintech is a Polyclonal antibody targeting PGLS in WB, ELISA applications with reactivity to Human samples 30560-1-AP targets PGLS in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information 6-phosphogluconolactonase (PGLS) ,the key enzyme of pentose phosphate pathway, was aberrantly highly expressed in various cancers, including cervical cancer, breast cancer, glioblastomas, and hepatic cancer, etc. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30836 Product name: Recombinant human PGLS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC014006 Sequence: MAAPAPGLISVFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLARELPAAVAPAGPASLARWTLGFCDERLVPFDHAESTYGLYRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLR Predict reactive species Full Name: 6-phosphogluconolactonase Observed Molecular Weight: 28 kDa GenBank Accession Number: BC014006 Gene Symbol: PGLS Gene ID (NCBI): 25796 RRID: AB_3086363 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95336 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924