Iright
BRAND / VENDOR: Proteintech

Proteintech, 30573-1-AP, SLAMF7/CD319 Polyclonal antibody

CATALOG NUMBER: 30573-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLAMF7/CD319 (30573-1-AP) by Proteintech is a Polyclonal antibody targeting SLAMF7/CD319 in WB, ELISA applications with reactivity to human samples 30573-1-AP targets SLAMF7/CD319 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: IM-9 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Signaling lymphocyte activation molecule (SLAM) family receptors is a group of type I transmembrane receptors belonging to the immunoglobulin superfamily (PMID: 37251372). The SLAM family contains nine members that contain an extracellular segment comprising two or four Ig-like domains (V-like variable and C2-like constant), a transmembrane region and a cytoplasmic tail (PMID: 29662641). They are involved in various physiological and pathological processes, including the regulation of immunological responses and the route of viral entry. SLAMF7, also known as CS1, CRACC or CD319, is expressed on NK cells, CD8+ T lymphocytes, B lymphocytes, and mature dendritic cells (PMID: 28861320). It exerts both activating and inhibitory effects depending on the expression status of SAP or EAT-2. SLAMF7 is overexpressed in multiple myeloma and makes it a target for immunotherapy (PMID: 28861320). The native molecular weight of SLAMF7 is 37 kDa and the apparent molecular mass shifts due to glycosylation (PMID: 11698418; 36381324). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0145 Product name: Recombinant Human SLAMF7/CD319 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 23-226 aa of BC027867 Sequence: SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM Predict reactive species Full Name: SLAM family member 7 Calculated Molecular Weight: 335 aa, 37 kDa Observed Molecular Weight: 66-80 kDa GenBank Accession Number: BC027867 Gene Symbol: SLAMF7 Gene ID (NCBI): 57823 RRID: AB_3669733 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQ25 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924