Iright
BRAND / VENDOR: Proteintech

Proteintech, 30577-1-AP, PM20D1 Polyclonal antibody

CATALOG NUMBER: 30577-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PM20D1 (30577-1-AP) by Proteintech is a Polyclonal antibody targeting PM20D1 in WB, ELISA applications with reactivity to human, mouse, rat samples 30577-1-AP targets PM20D1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse pancreas tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information PM20D1 is a secreted enzyme that regulates the endogenous N-fatty acyl amino acid (NAAs) tissue and circulating levels by functioning as a bidirectional NAA synthase/hydrolase (PMID: 27374330). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29154 Product name: Recombinant human PM20D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-202 aa of BC063477 Sequence: TVSRSMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEKSNTTALAEFGKYIHKVFPTVVSTSFIQHEVVEEYSHLFTIQGSDPSLQPYLLMAHFDVVPAPEEGWEVPPFSGLERDGVIYGWGTLDDKNSVMALLQALELLLIRKYIPRRSFFISLGHDEESSGTGAQRIS Predict reactive species Full Name: peptidase M20 domain containing 1 Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC063477 Gene Symbol: PM20D1 Gene ID (NCBI): 148811 RRID: AB_3086367 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6GTS8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924