Proteintech, 30621-1-AP, ADH1C Polyclonal antibody

Size: 20ul / 150ul The ADH1C (30621-1-AP) by Proteintech is a Polyclonal antibody targeting ADH1C in WB, ELISA applications with reactivity to mouse, rat samples 30621-1-AP targets ADH1C in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, mouse colon tissue, rat colon tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Alcohol dehydrogenase 1C(ADH1C), also known as ADH3, is an alcohol dehydrogenase that can catalyze ethanol oxidation to metabolite acetaldehyde. According to THE HUMAN PROTEIN ATLAS database, ADH1C locates mainly to the cytosol and plasma membrane. Genetic polymorphism of the ADH1C gene (ADH1C*1 allele) is associated with various human cancers, such as gastric cancer, oral cancer and CRC, for it encodes an alcohol dehydrogenase producing 2.5 times more acetaldehyde.(PMID: 35300114) Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33037 Product name: Recombinant human ADH1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-374 aa of BC062476 Sequence: ECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGQLDTMMASLLCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNVLPFEKINEGFDLLRSGKSIRTVLT Predict reactive species Full Name: alcohol dehydrogenase 1C (class I), gamma polypeptide Calculated Molecular Weight: 375 aa, 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC062476 Gene Symbol: ADH1C Gene ID (NCBI): 126 RRID: AB_3086375 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00326 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.