Proteintech, 30623-1-AP, PIGP Polyclonal antibody

Size: 20ul / 150ul The PIGP (30623-1-AP) by Proteintech is a Polyclonal antibody targeting PIGP in IP, ELISA applications with reactivity to human samples 30623-1-AP targets PIGP in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: U-87 MG cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Phosphatidylinositol glycan anchor biosynthesis, class P (PIGP), a member of the large glycosylphosphatidylinositol (GPI) anchor biosynthesis gene family, encodes a subunit of the enzyme that catalyzes the first step of GPI anchor biosynthesis (PMID: 28334793). Mutations in the PIGP gene can lead to a variety of disorders, including developmental delay, intellectual disability, seizures, dysmorphic features, and diverse congenital anomalies. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29498 Product name: Recombinant human PIGP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 70-134 aa of BC005180 Sequence: YVLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN Predict reactive species Full Name: phosphatidylinositol glycan anchor biosynthesis, class P Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 15~18 kDa GenBank Accession Number: BC005180 Gene Symbol: PIGP Gene ID (NCBI): 51227 RRID: AB_3669740 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P57054 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.