Iright
BRAND / VENDOR: Proteintech

Proteintech, 30648-1-AP, CTLA-4/CD152 Polyclonal antibody

CATALOG NUMBER: 30648-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CTLA-4/CD152 (30648-1-AP) by Proteintech is a Polyclonal antibody targeting CTLA-4/CD152 in WB, IHC, IF-P, ELISA applications with reactivity to mouse, rat samples 30648-1-AP targets CTLA-4/CD152 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: Con A treated mouse splenocytes Positive IHC detected in: rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CTLA-4, also known as CD152, belonging to the immunoglobulin superfamily, is primarily found on activated T cells and regulatory T cells (Tregs). CTLA-4 is closely related to the T-cell costimulatory CD28, and both molecules bind to B7-1 and B7-2 on antigen-presenting cells. CTLA-4 acts as a negative regulatory molecule of T-cell responses. Besides the full-length transmembrane form, CTLA-4 also exists in a truncated soluble form (sCTLA-4). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0632 Product name: Recombinant Mouse CTLA-4 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 36-162 aa of NM_009843.4 Sequence: EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDF Predict reactive species Full Name: cytotoxic T-lymphocyte-associated protein 4 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 28-40 kDa GenBank Accession Number: NM_009843.4 Gene Symbol: CTLA-4 Gene ID (NCBI): 12477 RRID: AB_3086380 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09793 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924