Proteintech, 30656-1-AP, DAPK3 Polyclonal antibody

Size: 20ul / 150ul The DAPK3 (30656-1-AP) by Proteintech is a Polyclonal antibody targeting DAPK3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 30656-1-AP targets DAPK3 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, Hela cells, HepG2 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DAPK3, also named as ZIPK and Dlk, belongs to the protein kinase superfamily, CAMK Ser/Thr protein kinase family and DAP kinase subfamily. The calculated molecular weight of DAPK3 is 52 kDa. This antibody can recognize the 37 kDa isoform of target. ZIP kinase is a Serine/threonine kinase which acts as a positive regulator of apoptosis. ZIP kinasephosphorylates histone H3 on 'Thr-11' at centromeres during mitosis. ZIP kinase regulates myosin light chain phosphatase through phosphorylation of MYPT1 thereby regulating the assembly of the actin cytoskeleton, cell migration, invasiveness of tumor cells, smooth muscle contraction and neurite outgrowth. It catalyze the reaction: ATP + a protein = ADP + a phosphoprotein. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33051 Product name: Recombinant human DAPK3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 252-361 aa of NM_001348 Sequence: IRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIYE Predict reactive species Full Name: death-associated protein kinase 3 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 37, 52 kDa GenBank Accession Number: NM_001348 Gene Symbol: DAPK3 Gene ID (NCBI): 1613 RRID: AB_3086381 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43293 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.