Proteintech, 30657-1-AP, PTGIR Polyclonal antibody

Size: 20ul / 150ul The PTGIR (30657-1-AP) by Proteintech is a Polyclonal antibody targeting PTGIR in WB, ELISA applications with reactivity to human samples 30657-1-AP targets PTGIR in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, SGC-7901 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Prostaglandin I2 receptor (PTGIR), also known as IP, is a seven-transmembrane receptor that binds G proteins leading to activation of adenylyl cyclase and an increase in cAMP formation. PTGIR is involved in insulin secretion in pancreatic beta-cells and in permselectivity in glomerular podocytes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30653 Product name: Recombinant human PTGIR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 296-386 aa of BC075814 Sequence: RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC Predict reactive species Full Name: prostaglandin I2 (prostacyclin) receptor (IP) Calculated Molecular Weight: 386 aa, 41 kDa Observed Molecular Weight: 41-45kDa GenBank Accession Number: BC075814 Gene Symbol: PTGIR Gene ID (NCBI): 5739 RRID: AB_3669746 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43119 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.