Proteintech, 30663-1-AP, SDHAF4 Polyclonal antibody

Size: 20ul / 150ul The SDHAF4 (30663-1-AP) by Proteintech is a Polyclonal antibody targeting SDHAF4 in IHC, IF/ICC, ELISA applications with reactivity to human samples 30663-1-AP targets SDHAF4 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human cervical cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells, U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SDHAF4 (Succinate Dehydrogenase Assembly Factor 4) is a key mitochondrial protein specifically responsible for assisting in the assembly and stability of mitochondrial complex II (Succinate Dehydrogenase, SDH). This complex plays a central role in cellular energy metabolism by participating simultaneously in the tricarboxylic acid (TCA) cycle and the electron transport chain. Its function involves binding to the SDHA (flavoprotein) subunit, which is already associated with FAD, thereby preventing excessive ROS generation. It further promotes the assembly of SDHA with the iron-sulfur protein SDHB to form the catalytic dimer. This ensures the proper integration of complex II into the inner mitochondrial membrane, allowing it to participate in both the TCA cycle and electron transport. Deficiency of SDHAF4 leads to reduced SDH activity, accumulation of succinate, and elevated mitochondrial superoxide levels, which are associated with certain cardiomyopathies and tumor metabolic reprogramming. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33549 Product name: Recombinant human C6orf57 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-108 aa of BC104649 Sequence: ARSPLLCHSLRKTSSSQGGKSELVKQSLKKPKLPEGRFDAPEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF Predict reactive species Full Name: chromosome 6 open reading frame 57 Observed Molecular Weight: 15 kDa GenBank Accession Number: BC104649 Gene Symbol: C6orf57 Gene ID (NCBI): 135154 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VUM1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.