Iright
BRAND / VENDOR: Proteintech

Proteintech, 30668-1-AP, PHEX Polyclonal antibody

CATALOG NUMBER: 30668-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PHEX (30668-1-AP) by Proteintech is a Polyclonal antibody targeting PHEX in WB, ELISA applications with reactivity to human, mouse, rat, hamster samples 30668-1-AP targets PHEX in WB, ELISA applications and shows reactivity with human, mouse, rat, hamster samples. Tested Applications Positive WB detected in: CHO cells, ROS1728 cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Phex encodes a 100- to 105-kDa transmembrane glycoprotein, which is present in bones and teeth of normal mice but not Hyp animals. Phex protein expression in femur and calvaria decreases with age, high levels of Phex detected in osteocytes make this protein an interesting marker to study the later stages of osteoblastic cell differentiation (PMID: 10934642). The 76 kDa represents the deglycosylated core-glycosylated forms within the ERs, the 95 kDa represents the core-glycosylated and unmatured form within the ERs, the 105 kDa species of PHEX protein represents the fully processed, matured for(PMID: 3251189, 35654784). Specification Tested Reactivity: human, mouse, rat, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33428 Product name: Recombinant human PHEX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 430-641 aa of BC105059 Sequence: DKKEMMEELVEGVRWAFIDMLEKENEWMDAGTKRKAKEKARAVLAKVGYPEFIMNDTHVNEDLKAIKFSEADYFGNVLQTRKYLAQSDFFWLRKAVPKTEWFTNPTTVNAFYSASTNQIRFPAGELQKPFFWGTEYPRSLSYGAIGVIVGHEFTHGFDNNGRKYDKNGNLDPWWSTESEEKFKEKTKCMINQYSNYYWKKAGLNVKGKRTLG Predict reactive species Full Name: phosphate regulating endopeptidase homolog, X-linked Calculated Molecular Weight: 749 aa, 86 kDa Observed Molecular Weight: 76-80 kDa, 95-100 kDa GenBank Accession Number: BC105059 Gene Symbol: PHEX Gene ID (NCBI): 5251 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78562 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924