Iright
BRAND / VENDOR: Proteintech

Proteintech, 30673-1-AP, MORF4L1 Polyclonal antibody

CATALOG NUMBER: 30673-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MORF4L1 (30673-1-AP) by Proteintech is a Polyclonal antibody targeting MORF4L1 in WB, ELISA applications with reactivity to Human samples 30673-1-AP targets MORF4L1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293T cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information MORF4L1, also named as MRG15, belongs to the MRG family. It is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. It is also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. (PMID:14966270) This antibody has no cross-reaction to MORF4L2. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33839 Product name: Recombinant human MORF4L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC022845 Sequence: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKK Predict reactive species Full Name: mortality factor 4 like 1 Calculated Molecular Weight: 362 aa, 41 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC022845 Gene Symbol: MORF4L1 Gene ID (NCBI): 10933 RRID: AB_3086384 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBU8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924