Iright
BRAND / VENDOR: Proteintech

Proteintech, 30674-1-AP, PITRM1 Polyclonal antibody

CATALOG NUMBER: 30674-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PITRM1 (30674-1-AP) by Proteintech is a Polyclonal antibody targeting PITRM1 in WB, IHC, ELISA applications with reactivity to Human samples 30674-1-AP targets PITRM1 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, human placenta tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information PITRM1 (Presequence protease, mitochondrial) is a ATP-independent protease that degrades mitochondrial transit peptides after their cleavage.It is specific for peptides in the range of 10 to 65 residues.and able to degrade amyloid beta A4 (APP) protein when it accumulates in mitochondrion, suggesting a link with Alzheimer disease.It shows a preference for cleavage after small polar residues and before basic residues, but without any positional preference(PMID:16849325).This protein has a calculated molecular mass of 117kD and it is expressed widely. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30478 Product name: Recombinant human PITRM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 258-410 aa of BC001150 Sequence: ILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLS Predict reactive species Full Name: pitrilysin metallopeptidase 1 Calculated Molecular Weight: 60 kDa, 117 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC001150 Gene Symbol: PITRM1 Gene ID (NCBI): 10531 RRID: AB_3086385 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5JRX3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924