Iright
BRAND / VENDOR: Proteintech

Proteintech, 30688-1-AP, CCDC23 Polyclonal antibody

CATALOG NUMBER: 30688-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCDC23 (30688-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC23 in IHC, ELISA applications with reactivity to human, mouse samples 30688-1-AP targets CCDC23 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CCDC23 also known as SVBP is a small vasohibin-binding protein of 66 amino acids, and functions as a chaperone of VASH1 in vascular endothelial cells(PMID: 20736312). SVBP enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin(PMID: 29146869, 31171830). Mutations in SVBP cause Neurodevelopmental disorders with ataxia, hypotonia, and microcephaly (NEDAHM)(PMID: 30607023, 31363758). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33650 Product name: Recombinant human CCDC23 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-66 aa of BC029427 Sequence: MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE Predict reactive species Full Name: coiled-coil domain containing 23 GenBank Accession Number: BC029427 Gene Symbol: CCDC23 Gene ID (NCBI): 374969 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N300 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924