Product Description
Size: 20ul / 150ul
The PDE8B (30708-1-AP) by Proteintech is a Polyclonal antibody targeting PDE8B in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples
30708-1-AP targets PDE8B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse brain tissue, human placenta tissue
Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse testis tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Background Information
Human phosphodiesterase (PDE) type 8B (PDE8B) is located at 5q14.1 and is known as the PDE with the highest affinity to cAMP.
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag33477 Product name: Recombinant human PDE8B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 374-440 aa of NM_003719 Sequence: FVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPS Predict reactive species
Full Name: phosphodiesterase 8B
Calculated Molecular Weight: 99kd
Observed Molecular Weight: 68-98 kDa
GenBank Accession Number: NM_003719
Gene Symbol: PDE8B
Gene ID (NCBI): 8622
RRID: AB_3086395
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O95263
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924