Iright
BRAND / VENDOR: Proteintech

Proteintech, 30717-1-AP, SATB2 Polyclonal antibody

CATALOG NUMBER: 30717-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SATB2 (30717-1-AP) by Proteintech is a Polyclonal antibody targeting SATB2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 30717-1-AP targets SATB2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse brain tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information SATB2, also named as KIAA1034, belongs to the CUT homeobox family. SATB2 binds to DNA at nuclear matrix- or scaffold-associated regions. STAB2 recognizes the sugar-phosphate structure of double-stranded DNA. SATB2 is a transcription factor controlling nuclear gene expression, by binding to matrix attachment regions (MARs) of DNA and inducing a local chromatin-loop remodeling. SATB2 acts as a docking site for several chromatin remodeling enzymes and also by recruiting corepressors (HDACs) or coactivators (HATs) directly to promoters and enhancers. It is required for the initiation of the upper-layer neurons (UL1) specific genetic program and for the inactivation of deep-layer neurons (DL) and UL2 specific genes, probably by modulating BCL11B expression. It is a repressor of Ctip2 and regulatory determinant of corticocortical connections in the developing cerebral cortex. SATB2 may play an important role in palate formation. SATB2 acts as a molecular node in a transcriptional network regulating skeletal development and osteoblast differentiation. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33523 Product name: Recombinant human SATB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 674-733 aa of BC098136 Sequence: GKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENADKSKAAPAEIDQR Predict reactive species Full Name: SATB homeobox 2 Calculated Molecular Weight: 733 aa, 83 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC098136 Gene Symbol: SATB2 Gene ID (NCBI): 23314 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPW6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924