Proteintech, 30719-1-AP, GBP3 Polyclonal antibody

Size: 20ul / 150ul The GBP3 (30719-1-AP) by Proteintech is a Polyclonal antibody targeting GBP3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 30719-1-AP targets GBP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HUVEC cells Positive IHC detected in: mouse cerebellum tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Guanylate-binding protein 3 (GBP3) is involved in the proliferation of glioma cells through regulating SQSTM1-ERK1/2 pathway. GBP3 has 2 isoforms, one is 595 amino acids long at 68 kDa and the other is at nearly 62 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33889 Product name: Recombinant human GBP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 535-595 aa of BC140837 Sequence: RERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI* Predict reactive species Full Name: guanylate binding protein 3 Observed Molecular Weight: 68 kDa GenBank Accession Number: BC140837 Gene Symbol: GBP3 Gene ID (NCBI): 2635 RRID: AB_3086400 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0R5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.