Proteintech, 30765-1-AP, GPAT3 Polyclonal antibody

Size: 20ul / 150ul The GPAT3 (30765-1-AP) by Proteintech is a Polyclonal antibody targeting GPAT3 in WB, IHC, ELISA applications with reactivity to human samples 30765-1-AP targets GPAT3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HT-1080 cells, A375 cells, Jurkat cells, MKN-45 cells Positive IHC detected in: mouse liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPAT3, also known as AGPAT9, is a member of the lysophosphatidic acid acyltransferase protein family. GPAT3 is an enzyme that catalyzes the conversion of glycerol-3-phosphate to lysophosphatidic acid in the synthesis of triacylglycerol. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33717 Product name: Recombinant human GPAT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-136 aa of Glycerol-3-phosphate acyltransferase 3 Sequence: SEIYMKILVKTLEWATIRIEKGTPKESILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQY* Predict reactive species Full Name: 1-acylglycerol-3-phosphate O-acyltransferase 9 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: Glycerol-3-phosphate acyltransferase 3 Gene Symbol: AGPAT9 Gene ID (NCBI): 84803 RRID: AB_3086413 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53EU6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.