Iright
BRAND / VENDOR: Proteintech

Proteintech, 30774-1-AP, KIF15 Polyclonal antibody

CATALOG NUMBER: 30774-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KIF15 (30774-1-AP) by Proteintech is a Polyclonal antibody targeting KIF15 in WB, ELISA applications with reactivity to human samples 30774-1-AP targets KIF15 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cels, K-562 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information KIF15, also named as KLP2 and KNSL7, belongs to the kinesin-like protein family and KLP2 subfamily. It is a plus-end directed kinesin-like motor enzyme which involved in mitotic spindle assembly. It is located in the cytoplasm and biased expression in testis. Several isoforms of KIF15 exist due to the alternative splicing, with molecular weight between 130-160 kDa. Sometimes higher molecular weight around 200 kDa can also be observed, which may be a modified variant of KIF15 (14618103). It is known that KIF15 participates in important events during neuronal development and involves multiple cellular processes such as proliferation, apoptosis, and differentiation. There is emerging evidence indicating that KIF15 plays an important role in several malignancies including pancreatic cancer, hepatocellular carcinoma, and breast cancer (PMID: 33277366). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33897 Product name: Recombinant human KIF15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 950-1050 aa of NM_020242 Sequence: EQQMAKVQKLEESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILDLKETLRLR Predict reactive species Full Name: kinesin family member 15 Calculated Molecular Weight: 160 kDa Observed Molecular Weight: 145-150 kDa GenBank Accession Number: NM_020242 Gene Symbol: KIF15 Gene ID (NCBI): 56992 RRID: AB_3086416 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NS87 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924