Proteintech, 30800-1-AP, OGFOD1 Polyclonal antibody

Size: 20ul / 150ul The OGFOD1 (30800-1-AP) by Proteintech is a Polyclonal antibody targeting OGFOD1 in WB, IHC, ELISA applications with reactivity to human samples 30800-1-AP targets OGFOD1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, DU 145 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1 (OGFOD1) is a proly hydroxylase which belongs to 2-OG-Fe (II) dioxygenase family, it also namely KIAA1612 and TPA1. OGFOD1 is expressed in many tissues, mainly located in the nucleoplasm. It increased in many cancers and regulates both transcription and translation. The apparent molecular weight is larger than the calculated molecular weight of 63 kDa, which is likely due to posttranslational modification, presumably by glycosylation. (PMID:34298635 and 20579638) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34034 Product name: Recombinant human OGFOD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 193-542 aa of BC032919 Sequence: PKQIVKSLIPSWNKLVFFEVSPVSFHQVSEVLSEEKSRLSISGWFHGPSLTRPPNYFEPPIPRSPHIPQDHEILYDWINPTYLDMDYQVQIQEEFEESSEILLKEFLKPEKFTKVCEALEHGHVEWSSRGPPNKRFYEKAEESKLPEILKECMKLFRSEALFLLLSNFTGLKLHFLAPSEEDEMNDKKEAETTDITEEGTSHSPPEPENNQMAISNNSQQSNEQTDPEPEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSFIYYE Predict reactive species Full Name: 2-oxoglutarate and iron-dependent oxygenase domain containing 1 Calculated Molecular Weight: 542 aa, 63 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC032919 Gene Symbol: OGFOD1 Gene ID (NCBI): 55239 RRID: AB_3086419 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N543 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.