Proteintech, 30843-1-AP, SLC6A20 Polyclonal antibody

Size: 20ul / 150ul The SLC6A20 (30843-1-AP) by Proteintech is a Polyclonal antibody targeting SLC6A20 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 30843-1-AP targets SLC6A20 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, HEK-293 cells, rat kidney tissue Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SLC6A20 also known as XT3, SIT1, belongs to the family of solute carrier 6, mediating the transport of neutral amino acids from the extracellular milieu toward cell or storage vesicles utilizing an electric membrane potential as the driving force. SLC6A20 is expressed in the kidney and small intestine and is localized in the brush marginal membrane of the proximal renal tubules (PMID: 16174864). Mutations in SLC6A20 are associated with Hyperglycinuria and Iminoglycinuria (PMID: 19033659) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33967 Product name: Recombinant human SLC6A20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 298-389 aa of BC136431 Sequence: YGFKATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQGTGLAFIVYTEAIKNMEVSQ Predict reactive species Full Name: solute carrier family 6 (proline IMINO transporter), member 20 Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC136431 Gene Symbol: SLC6A20 Gene ID (NCBI): 54716 RRID: AB_3669764 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NP91 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.