Iright
BRAND / VENDOR: Proteintech

Proteintech, 30848-1-AP, NPY5R Polyclonal antibody

CATALOG NUMBER: 30848-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NPY5R (30848-1-AP) by Proteintech is a Polyclonal antibody targeting NPY5R in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30848-1-AP targets NPY5R in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spinal cord tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Neuropeptide Y receptor Y5 (NPY5R) is a G protein-coupled receptor (GPCR) that belongs to the neuropeptide Y receptor family and is primarily involved in regulating food intake, energy metabolism, and various physiological processes. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5428 Product name: Recombinant human NPY5R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-382 aa of BC042416 Sequence: CGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWM Predict reactive species Full Name: neuropeptide Y receptor Y5 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC042416 Gene Symbol: NPY5R Gene ID (NCBI): 4889 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q15761 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924