Proteintech, 30861-1-AP, SGLT1 Polyclonal antibody

Size: 20ul / 150ul The SGLT1 (30861-1-AP) by Proteintech is a Polyclonal antibody targeting SGLT1 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 30861-1-AP targets SGLT1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: 37°C incubated rat kidney tissue, HeLa cells, mouse colon tissue, Jurkat cells, Raji cells, mouse kidney tissue, mouse small intestine tissue, rat colon tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse small intestine tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information SLC5A1, also known as SGLT1, is a sodium-dependent glucose transporter (SGLT) family member. SGLT1 couples sugar transport to Na+ gradients across the intestinal brush border (PMID: 8563765). SGLT1 mediates active glucose and galactose absorption in the intestine and renal glucose scavenging. Mutations in SGLT1 cause glucose-galactose malabsorption (GGM) syndrome (PMID: 34880492). SGLT1 is expressed in intestine and endometrial cells (PMID: 2490366, 28974690). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29338 Product name: Recombinant human SLC5A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 564-643 aa of NM_000343 Sequence: RNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRT Predict reactive species Full Name: solute carrier family 5 (sodium/glucose cotransporter), member 1 Calculated Molecular Weight: 73 kDa Observed Molecular Weight: 73 kDa GenBank Accession Number: NM_000343 Gene Symbol: SGLT1 Gene ID (NCBI): 6523 RRID: AB_3669767 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13866 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.