Proteintech, 30880-1-AP, CD147 Polyclonal antibody

Size: 20ul / 150ul The CD147 (30880-1-AP) by Proteintech is a Polyclonal antibody targeting CD147 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 30880-1-AP targets CD147 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HepG2 cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CD147, also known as Basigin or extracellular matrix metalloproteinase inducer (EMMPRIN), is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 7812975). The molecule is composed of an intracellular portion, an extracellular portion and a single transmembrane region. CD147 is expressed on a variety of cell types (e.g., hematopoietic, epithelial, and endothelial cells) and at varying levels (PMID: 32968061). Increased expression of CD147 occurs in many tumors. CD147 is a pleiotropic molecule that plays an important role in fetal, neuronal, lymphocyte and extracellular matrix development (PMID: 17945211). CD147 has been identified as a receptor essential for erythrocyte invasion by Plasmodium falciparum (PMID: 22080952). It has been reported that spike protein of SARS-CoV-2 binds to CD147 on host cells, thereby mediating the viral invasion (Wang, Ke, et al, BioRxiv, 2020). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0436 Product name: Recombinant Human CD147 protein (His Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 138-323 aa of BC009040 Sequence: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA Predict reactive species Full Name: basigin (Ok blood group) Calculated Molecular Weight: 385 aa, 42 kDa Observed Molecular Weight: 35-55 kDa GenBank Accession Number: BC009040 Gene Symbol: CD147 Gene ID (NCBI): 682 RRID: AB_3669773 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35613 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.