Iright
BRAND / VENDOR: Proteintech

Proteintech, 30922-1-AP, SPP2 Polyclonal antibody

CATALOG NUMBER: 30922-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPP2 (30922-1-AP) by Proteintech is a Polyclonal antibody targeting SPP2 in WB, ELISA applications with reactivity to human samples 30922-1-AP targets SPP2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information SPP2 (Secreted phosphoprotein 24), also known as SPP24. SPP2 is a secreted phosphoprotein, which was originally isolated and purified from bovine bone density. It is widely distributed in the body, mainly produced in the liver and transported to other tissues. SPP2 is expressed in many tissues, especially in the liver. Studies have shown that the expression level of SPP2 is up-regulated in liver cirrhosis. In addition, the expression of SPP2 is significantly related to many genes, including APOA1, SLC2A2 and TTR (PMID: 38448371). SPP2 has many biological functions, including: it can inhibit the activity of cysteine protease, participate in bone formation, inhibit calcification, and regulate BMP/TGF-β signaling pathway. SPP2 may be a tumor suppressor, which inhibits the development of HCC by inhibiting BMP/TGF-β signaling pathway. The molecular weight of SPP2 is 24 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29299 Product name: Recombinant human SPP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-211 aa of NM_006944 Sequence: FPVYDYDPSSLRDALSASVVKVNSQSLSPYLFRAFRSSLKRVEVLDENNLVMNLEFSIRETTCRKDSGEDPATCAFQRDYYVSTAVCRSTVKVSAQQVQGVHARCSWSSSTSESYSSEEMIFGDMLGSHKWRNNYLFGLISDESISEQFYDRSLGIMRRVLPPGNRRYPNHRHRARINTDFE Predict reactive species Full Name: secreted phosphoprotein 2, 24kDa Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: NM_006944 Gene Symbol: SPP2 Gene ID (NCBI): 6694 RRID: AB_3669785 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13103 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924