Proteintech, 30941-1-AP, RNF180 Polyclonal antibody

Size: 20ul / 150ul The RNF180 (30941-1-AP) by Proteintech is a Polyclonal antibody targeting RNF180 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 30941-1-AP targets RNF180 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, A549 cells, mouse kindey tissue, mouse liver tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34138 Product name: Recombinant human RNF180 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-416 aa of BC101277 Sequence: ATRAFHRKSHSLDLNISEKLTLLPTLYEIHSKTTAYSRLNETQPIDLSGLPLQSSKNSYSFQNPSSFDPSMLLQRFSVAPHETQTQRGGEFQCGLEAASVYSDHTNTNNLTFLMDLPSAGRSMPEASDQEEHLSPLDFLHSANFSLGSINQRLNKRERSKLKNLRRKQRRRERWLQKQGKYSGVGLLDHMVSIYLLI Predict reactive species Full Name: ring finger protein 180 Calculated Molecular Weight: 592 aa, 68 kDa Observed Molecular Weight: 70 kDa,48kDa GenBank Accession Number: BC101277 Gene Symbol: RNF180 Gene ID (NCBI): 285671 RRID: AB_3669788 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86T96 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.