Iright
BRAND / VENDOR: Proteintech

Proteintech, 31019-1-AP, SLC35D1 Polyclonal antibody

CATALOG NUMBER: 31019-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC35D1 (31019-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35D1 in WB, ELISA applications with reactivity to human, mouse, rat samples 31019-1-AP targets SLC35D1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SLC35D1 belongs to the TPT transporter family and is a nucleotide sugar transporter (NST) expressed in the endoplasmic reticulum. Loss-of-function mutations in SLC35D1 cause Schneckenbecken dysplasia, a severe skeletal dysplasia (PMID: 19508970; 35934917). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34372 Product name: Recombinant human SLC35D1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 89-157 aa of BC093786 Sequence: VGKALRVVKFPDLDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGVLLKKT Predict reactive species Full Name: solute carrier family 35 (UDP-glucuronic acid/UDP-N-acetylgalactosamine dual transporter), member D1 Calculated Molecular Weight: 355 aa, 39 kDa Observed Molecular Weight: 35-39 kDa GenBank Accession Number: BC093786 Gene Symbol: SLC35D1 Gene ID (NCBI): 23169 RRID: AB_3669816 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NTN3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924