Iright
BRAND / VENDOR: Proteintech

Proteintech, 31053-1-AP, TRIM43 Polyclonal antibody

CATALOG NUMBER: 31053-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRIM43 (31053-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM43 in WB, ELISA applications with reactivity to human, mouse samples 31053-1-AP targets TRIM43 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, Jurkat cells, U-87 MG cells, mouse brain tissue Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information TRIM43 (tripartite motif containing 43), also known as TRIM43A. It is expected to be located in the cytoplasm. The calculated molecular weight of TRIM43 is 52 kDa. TRIM43 was also upregulated in herpesvirus-associated diseases in humans, including γ herpesvirus-associated tumors. As such, TRIM43 and its transcription factor DUX4 could potentially serve as biomarkers of active herpesviral replication and pathogenesis (PMID: 30420784). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34926 Product name: Recombinant human TRIM43 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-240 aa of BC015353 Sequence: LLKQMRILWKKIQENQRNLYEEGRTAFLWRGNVVLRAQMIRNEYRKLHPVLHKEEKQHLERLNKEYQEIFQQLQRSWVKMDQKSKHLKEMYQELMEMCHKP Predict reactive species Full Name: tripartite motif-containing 43 Observed Molecular Weight: 52-60 kDa GenBank Accession Number: BC015353 Gene Symbol: TRIM43 Gene ID (NCBI): 129868 RRID: AB_3669834 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96BQ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924