Iright
BRAND / VENDOR: Proteintech

Proteintech, 31061-1-AP, IFI35 Polyclonal antibody

CATALOG NUMBER: 31061-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IFI35 (31061-1-AP) by Proteintech is a Polyclonal antibody targeting IFI35 in WB, ELISA applications with reactivity to Human samples 31061-1-AP targets IFI35 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Jurkat cells, SW480 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information IFI35 (interferon induced protein 35), also known as IFP35. It is expected to be located in cytoplasm, nucleus and extracellular space. The protein is expressed in a wide range of cell types, including fibroblasts, macrophages, and epithelial cells. Involved in several processes, including macrophage activation involved in immune response; positive regulation of defense response; and regulation of signal transduction. And the calculated molecular weight of IFI35 is 31 kDa. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34653 Product name: Recombinant human IFI35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-203 aa of BC001356 Sequence: RKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVP Predict reactive species Full Name: interferon-induced protein 35 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31-35 kDa GenBank Accession Number: BC001356 Gene Symbol: IFI35 Gene ID (NCBI): 3430 RRID: AB_3669837 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P80217 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924