Iright
BRAND / VENDOR: Proteintech

Proteintech, 31067-1-AP, NLRC5 Polyclonal antibody

CATALOG NUMBER: 31067-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NLRC5 (31067-1-AP) by Proteintech is a Polyclonal antibody targeting NLRC5 in WB, IHC, ELISA applications with reactivity to human samples 31067-1-AP targets NLRC5 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: IFN gamma treated THP-1 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information The nucleotide-binding domain leucine-rich repeat containing (NLR) family of proteins is mainly involved in microbial pathogen recognition, inflammatory responses, and cell death. NLRC5, the largest member of the NLR family, is currently receiving an increasing level of attention. NLRC5 plays a role in cytokine response and antiviral immunity through its inhibition of NF-kappa-B activation and negative regulation of type I interferon signaling pathways. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34508 Product name: Recombinant human NLRC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC063566 Sequence: MDPVGLQLGNKNLWSCLVRLLTKDPEWLNAKMKFFLPNTDLDSRNETLDPEQRVILQLNKLHVQGSDTWQSFIHCVCMQLEVPLDLEVLLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKKQQLELAKKYLQLLRTSAQQRYR Predict reactive species Full Name: NLR family, CARD domain containing 5 Calculated Molecular Weight: 204 kDa Observed Molecular Weight: 200 kDa GenBank Accession Number: BC063566 Gene Symbol: NLRC5 Gene ID (NCBI): 84166 RRID: AB_3669840 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86WI3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924