Iright
BRAND / VENDOR: Proteintech

Proteintech, 31091-1-AP, CORO1B Polyclonal antibody

CATALOG NUMBER: 31091-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CORO1B (31091-1-AP) by Proteintech is a Polyclonal antibody targeting CORO1B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 31091-1-AP targets CORO1B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, MDA-MB-453 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse liver tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CORO1B (Coronin 1B) is an actin-binding protein that controls actin networks at classical lamellipodia (PMID: 32850828). Coro1B localizes to the plasma membrane, regulates lamellipodia formation, and when phosphorylated, it can no longer bind ARP2/3 and inhibit its actin nucleation abilities (PMID: 22619279). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34813 Product name: Recombinant human CORO1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 393-489 aa of BC006449 Sequence: REAYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA Predict reactive species Full Name: coronin, actin binding protein, 1B Calculated Molecular Weight: 498 aa, 54 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC006449 Gene Symbol: CORO1B Gene ID (NCBI): 57175 RRID: AB_3669849 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BR76 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924