Iright
BRAND / VENDOR: Proteintech

Proteintech, 31092-1-AP, ARHGAP19 Polyclonal antibody

CATALOG NUMBER: 31092-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARHGAP19 (31092-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGAP19 in WB, IHC, ELISA applications with reactivity to human samples 31092-1-AP targets ARHGAP19 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, MCF-7 cells, Jurkat cells, K-562 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34671 Product name: Recombinant human ARHGAP19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 388-494 aa of BC114490 Sequence: KKKQLIRQFNKQSLTQTPGREPSTSQVQKRARSRSFSGLIKRKVLGNQMMSEKKKKNPTPESVAIGELKGTSKENRNLLFSGSPAVTMTPTRLKWSEGKKEGKKGFL Predict reactive species Full Name: Rho GTPase activating protein 19 Observed Molecular Weight: 54 kDa GenBank Accession Number: BC114490 Gene Symbol: ARHGAP19 Gene ID (NCBI): 84986 RRID: AB_3669850 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14CB8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924