Iright
BRAND / VENDOR: Proteintech

Proteintech, 31102-1-AP, SP100 Polyclonal antibody

CATALOG NUMBER: 31102-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SP100 (31102-1-AP) by Proteintech is a Polyclonal antibody targeting SP100 in WB, ELISA applications with reactivity to Human samples 31102-1-AP targets SP100 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SP100 nuclear antigen, belongs to the nuclear bodies(NBs), has a role in the control of gene expression. It contains a HSR domain, which is important for the nuclear body targeting as well as for the dimerization, and one PxVxL motif, which if required for interaction with chromoshadow domains. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35193 Product name: Recombinant human SP100 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 141-300 aa of BC011562 Sequence: YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK Predict reactive species Full Name: SP100 nuclear antigen Calculated Molecular Weight: 879 aa, 100 kDa Observed Molecular Weight: 75-85 kDa GenBank Accession Number: BC011562 Gene Symbol: SP100 Gene ID (NCBI): 6672 RRID: AB_3669856 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P23497 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924