Proteintech, 31122-1-AP, AGER/RAGE Polyclonal antibody

Size: 20ul / 150ul The AGER/RAGE (31122-1-AP) by Proteintech is a Polyclonal antibody targeting AGER/RAGE in WB, IHC, ELISA applications with reactivity to mouse, rat samples 31122-1-AP targets AGER/RAGE in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, rat lung tissue Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information The receptor for advanced glycation end products (RAGE) is a cell surface transmembrane multiligand receptor, also known as Ager, is a multiligand member of the immunoglobulin superfamily. It has many isoforms and is predominantly expressed in the lung. AGER expression is upregulated in many diseases such as Alzheimer's disease, diabetes mellitus, atherosclerosis, and rheumatoid arthritis (PMID: 35099614). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0873 Product name: Recombinant mouse RAGE protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-340 aa of NM_007425.3 Sequence: GQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLA Predict reactive species Full Name: advanced glycosylation end product-specific receptor Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 42-55 kDa GenBank Accession Number: NM_007425.3 Gene Symbol: Ager Gene ID (NCBI): 11596 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q62151-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.