Iright
BRAND / VENDOR: Proteintech

Proteintech, 31163-1-AP, GANC Polyclonal antibody

CATALOG NUMBER: 31163-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GANC (31163-1-AP) by Proteintech is a Polyclonal antibody targeting GANC in WB, ELISA applications with reactivity to human, mouse samples 31163-1-AP targets GANC in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information GANC (Glucosidase Alpha, Neutral C) is a Protein Coding gene. Diseases associated with GANC include Pompe Disease and Autosomal Recessive Limb-Girdle Muscular Dystrophy Type 2A. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35067 Product name: Recombinant human GANC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-210 aa of BC059406 Sequence: VTTDEDSTRFQIINEASKVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGSLILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEETSVDTSQENQEDLGLWEEKFGKFVDIKANGP Predict reactive species Full Name: glucosidase, alpha; neutral C Calculated Molecular Weight: 104 kDa Observed Molecular Weight: 100-105 kDa GenBank Accession Number: BC059406 Gene Symbol: GANC Gene ID (NCBI): 2595 RRID: AB_3669877 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8TET4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924