Iright
BRAND / VENDOR: Proteintech

Proteintech, 31170-1-AP, KLF2 Polyclonal antibody

CATALOG NUMBER: 31170-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KLF2 (31170-1-AP) by Proteintech is a Polyclonal antibody targeting KLF2 in WB, ELISA applications with reactivity to human, mouse samples 31170-1-AP targets KLF2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: bEnd.3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33962 Product name: Recombinant human KLF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-225 aa of NM_016270 Sequence: GLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDA Predict reactive species Full Name: Kruppel-like factor 2 (lung) Calculated Molecular Weight: 37KD Observed Molecular Weight: 37-40 kDa GenBank Accession Number: NM_016270 Gene Symbol: KLF2 Gene ID (NCBI): 10365 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y5W3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924