Iright
BRAND / VENDOR: Proteintech

Proteintech, 31196-1-AP, S100a10 Polyclonal antibody

CATALOG NUMBER: 31196-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The S100a10 (31196-1-AP) by Proteintech is a Polyclonal antibody targeting S100a10 in WB, ELISA applications with reactivity to human, mouse samples 31196-1-AP targets S100a10 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HaCaT cells, RAW 264.7 cells, mouse lung tissue, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information S100A10 (also known as p11) is a member of the S100 family of EF-hand-type Ca2+-binding proteins and participates in various biological processes . The overexpression of S100A10 and S100A2 in CRCs may be used for prognosis assessment in relapse CRCs after adjuvant 5-fluorouracil (5-Fu) therapy and radical surgery. S100A10 usually associates with annexin A2 (ANXA2, p36) to form a heterotetramer complex (AIIt) and is mainly localized to the cell membrane and cytoplasm. (PMID: 34336846) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35034 Product name: Recombinant mouse S100a10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of NM_009112 Sequence: MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK Predict reactive species Full Name: S100 calcium binding protein A10 (calpactin) Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: NM_009112 Gene Symbol: S100a10 Gene ID (NCBI): 20194 RRID: AB_3669895 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P08207 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924