Iright
BRAND / VENDOR: Proteintech

Proteintech, 31200-1-AP, CCDC85C Polyclonal antibody

CATALOG NUMBER: 31200-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCDC85C (31200-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC85C in WB, ELISA applications with reactivity to human samples 31200-1-AP targets CCDC85C in applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, MCF-7 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information Ccdc85c (coiled-coil domain containing 85c) is a gene encoding protein, which is located on human chromosome 14 (14q32.2) and belongs to the helical loop domain protein family. The protein is mainly expressed in the neuroepithelial cells of the lateral ventricle wall of the brain, especially at the top junction of radial glial cells. In addition, it is also expressed in a variety of monolayer epithelial cells, but not in stratified epithelial cells. CCDC85C is the pathogenic gene of hereditary hydrocephalus and subcortical endometriosis (often accompanied by cerebral hemorrhage). In CCDC85C gene knockout (KO) mice and rats, abnormal development of ventricular system was observed, resulting in hydrocephalus and cerebral hemorrhage (PMID: 37271245). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35157 Product name: Recombinant human CCDC85C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-390 aa of NM_001144995 Sequence: HHHVPPPLLPPGPHKAPDGKAGATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRQLESKVRLLEGDKLLAQQAGSGEFRTLRKGFSPYHSESQLASLPPSYQDSLQNGPACPAPELPSPPSAGYSPAGQKPEAVVHAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCN Predict reactive species Full Name: coiled-coil domain containing 85C Calculated Molecular Weight: 419 aa, 45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: NM_001144995 Gene Symbol: CCDC85C Gene ID (NCBI): 317762 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A6NKD9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924