Iright
BRAND / VENDOR: Proteintech

Proteintech, 31229-1-AP, PI3 Kinase p110 Gamma Polyclonal antibody

CATALOG NUMBER: 31229-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PI3 Kinase p110 Gamma (31229-1-AP) by Proteintech is a Polyclonal antibody targeting PI3 Kinase p110 Gamma in WB, IHC, ELISA applications with reactivity to human, mouse samples 31229-1-AP targets PI3 Kinase p110 Gamma in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, mouse spleen tissue, mouse thymus tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34951 Product name: Recombinant human PIK3CG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 305-482 aa of BC035683 Sequence: VVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEYVL Predict reactive species Full Name: phosphoinositide-3-kinase, catalytic, gamma polypeptide Calculated Molecular Weight: 126 kDa Observed Molecular Weight: 126 kDa GenBank Accession Number: BC035683 Gene Symbol: PIK3CG Gene ID (NCBI): 5294 RRID: AB_3669910 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P48736 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924