Proteintech, 31237-1-AP, C18orf32 Polyclonal antibody

Size: 20ul / 150ul The C18orf32 (31237-1-AP) by Proteintech is a Polyclonal antibody targeting C18orf32 in WB, ELISA applications with reactivity to Human samples 31237-1-AP targets C18orf32 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: U2OS cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35313 Product name: Recombinant human C18orf32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of NM_001199346.1 Sequence: MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKKD Predict reactive species Full Name: chromosome 18 open reading frame 32 Calculated Molecular Weight: 9kDa，76aa Observed Molecular Weight: 12 kDa GenBank Accession Number: NM_001199346.1 Gene Symbol: C18orf32 Gene ID (NCBI): 497661 RRID: AB_3669914 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8TCD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.