Iright
BRAND / VENDOR: Proteintech

Proteintech, 31253-1-AP, HO-1/Hmox1 Polyclonal antibody

CATALOG NUMBER: 31253-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HO-1/Hmox1 (31253-1-AP) by Proteintech is a Polyclonal antibody targeting HO-1/Hmox1 in WB, ELISA applications with reactivity to mouse samples 31253-1-AP targets HO-1/Hmox1 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: J774A.1 cells, RAW 264.7 cells, RAW 264.7 cells mouse kidney tissue mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information Heme Oxygenase-1 (HO-1) is a stress-inducible enzyme that plays a crucial role in cellular and tissue homeostasis. It is the rate-limiting enzyme responsible for the oxidative degradation of heme, producing carbon monoxide (CO), free iron, and biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. These byproducts have significant biological activities, contributing to HO-1's anti-inflammatory, cytoprotective, and immunomodulatory effects. (PMID: 33923744) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0938 Product name: Recombinant mouse HO-1/Hmox1 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 1-266 aa of NM_010442.2 Sequence: MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQT Predict reactive species Full Name: heme oxygenase (decycling) 1 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: NM_010442.2 Gene Symbol: HO-1 Gene ID (NCBI): 15368 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14901 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924