Proteintech, 31265-1-AP, Apolipoprotein AI Polyclonal antibody

Size: 20ul / 150ul The Apolipoprotein AI (31265-1-AP) by Proteintech is a Polyclonal antibody targeting Apolipoprotein AI in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 31265-1-AP targets Apolipoprotein AI in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, HepG2 cells, mouse lung tissue, mouse spleen tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ApoA1 is a major protein component of high density lipoproteins (HDL) which is associated with reversed cholesterol transport, lipid/cholesterol binding, lecithin/cholesterol acyltransferase (LCAT) activation and specific receptors binding. It is synthesized in the liver and small intestine. Defects of ApoA1 cause low HDL level and systemic non-neuropathic amyloidosis. Serum concentration of ApoA1 is inversely related to the risk of developing atherosclerosis. This antibody was generated against the C-terminal region of human ApoA1. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0757 Product name: Recombinant Human APOA1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 25-267 aa of BC005380 Sequence: DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ Predict reactive species Full Name: apolipoprotein A-I Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC005380 Gene Symbol: APOA1 Gene ID (NCBI): 335 RRID: AB_3669923 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P02647 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.