Proteintech, 31282-1-AP, FBXO38 Polyclonal antibody

Size: 20ul / 150ul The FBXO38 (31282-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO38 in WB, ELISA applications with reactivity to human, mouse samples 31282-1-AP targets FBXO38 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information F-box containing protein 38 (FBXO38; also known as MoKA) is a substrate receptor for SKP1-CUL1-dependent ubiquitin ligase (SCF). Initially, it was discovered as a modulator of transcription factor Krüppel-like factor 7 (KLF7) activity (PMID: 14729953). In addition, FBXO38 stability is controlled via ubiquitin-specific peptidase 7 (USP7), and FBXO38 protein expression was shown to be required for proper cytokinesis (PMID: 30804394). However, as a ubiquitin ligase, SCFFBXO38 is still insufficiently characterized. So far, the only potential substrate identified is programmed cell death 1 (PD-1) (PMID: 30487606, PMID: 35813202). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35444 Product name: Recombinant human FBXO38 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 490-700 aa of XM_005268513.1 Sequence: SNQNSNNDDNNAQNNNANIHDNNHHHPDDSDEENDFRQDLQPGEQQFAADALNEMEDIVQEDGEVVAESGNNTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSESDDEEDSLELQEVWIPKNGTRRYSEREEKTGESVQSRELSVSGKGKTPLRKRYNSHQMGQSKQFPLEESSCEKGCQVTSEQIKADMKAARDIPEKKKNKDV Predict reactive species Full Name: F-box protein 38 Calculated Molecular Weight: 134kDa，1188aa Observed Molecular Weight: 140 kDa, 107 kDa GenBank Accession Number: XM_005268513.1 Gene Symbol: FBXO38 Gene ID (NCBI): 81545 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PIJ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.