Proteintech, 31289-1-AP, SLC24A2 Polyclonal antibody

Size: 20ul / 150ul The SLC24A2 (31289-1-AP) by Proteintech is a Polyclonal antibody targeting SLC24A2 in WB, ELISA applications with reactivity to Human samples 31289-1-AP targets SLC24A2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: ARPE-19 cells, hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35294 Product name: Recombinant human SLC24A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-132 aa of NM_020344 Sequence: SETDTQSTGEASVVSGPRVAQGYHQRTLLDLNDKILDYTPQPPLSKEGESENSTDHAQGDYPKDIFSLEERRK Predict reactive species Full Name: solute carrier family 24 (sodium/potassium/calcium exchanger), member 2 Calculated Molecular Weight: 661 aa, 74 kDa Observed Molecular Weight: 73-75 kDa GenBank Accession Number: NM_020344 Gene Symbol: SLC24A2 Gene ID (NCBI): 25769 RRID: AB_3669931 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UI40 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.