Iright
BRAND / VENDOR: Proteintech

Proteintech, 31296-1-AP, PPL Polyclonal antibody

CATALOG NUMBER: 31296-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPL (31296-1-AP) by Proteintech is a Polyclonal antibody targeting PPL in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 31296-1-AP targets PPL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, mouse skin tissue, rat skin tissue Positive IHC detected in: mouse skin tissue, rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HaCaT cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Periplakin (PPL) is a main member in plakin family, which serve as epidermal cytolinkers and components of cell-cell and cell-matrix adhesion complexes, i.e., desmosomes and hemidesmosomes, respectively (PMID: 35612641). Periplakin participates with dynamic changes in the keratin cytoskeleton via its C-terminal linker domain that co-localises with okadaic-acid-treated keratin granules (PMID: 17158917). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34952 Product name: Recombinant human PPL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-250 aa of BC114620 Sequence: AKMQSDLARLQEGRQPEHRDVTLQKVLDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYRLAVKEVDPQVNWAALVEEKLDKLNNQSFGTDLPLVDHQVEEHNIFHNEVKAIGPHLAKDGDKEQNSELRAKYQKLLAASQARQQHLSSLQDYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPS Predict reactive species Full Name: periplakin Observed Molecular Weight: 205 kDa GenBank Accession Number: BC114620 Gene Symbol: PPL Gene ID (NCBI): 5493 RRID: AB_3669933 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O60437 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924