Iright
BRAND / VENDOR: Proteintech

Proteintech, 31304-1-AP, DIAPH2 Polyclonal antibody

CATALOG NUMBER: 31304-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DIAPH2 (31304-1-AP) by Proteintech is a Polyclonal antibody targeting DIAPH2 in WB, ELISA applications with reactivity to human samples 31304-1-AP targets DIAPH2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information In vertebrates, three DRF genes (DIAPH1, DIAPH2 and DIAPH3) are the orthologs of the Drosophila melanogaster diaphanous (dia) gene, which has important roles in fertility and hearing in the fly. DIAPH1 and DIAPH3 have been associated with different types of hearing loss (HL). DIAPH2, located on chromosome Xq21.33, until now it has only been linked to premature ovarian failure 2 (POF2A). (PMID: 36689403) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35280 Product name: Recombinant human DIAPH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-146 aa of NM_006729.4 Sequence: GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT Predict reactive species Full Name: diaphanous homolog 2 (Drosophila) Calculated Molecular Weight: 126kDa Observed Molecular Weight: 126-130 kDa GenBank Accession Number: NM_006729.4 Gene Symbol: DIAPH2 Gene ID (NCBI): 1730 RRID: AB_3669941 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O60879 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924