Iright
BRAND / VENDOR: Proteintech

Proteintech, 31329-1-AP, SLC10A4 Polyclonal antibody

CATALOG NUMBER: 31329-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC10A4 (31329-1-AP) by Proteintech is a Polyclonal antibody targeting SLC10A4 in WB, ELISA applications with reactivity to Human, mouse, rat samples 31329-1-AP targets SLC10A4 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SLC10A4 belongs to the solute carrier superfamily and is a protease-activated transporter involved in uptake of bile acid (PMID: 23589386). SLC10A4 is expressed with a high expression in brain and is a vesicular monoaminergic and cholinergic-associated transporter that is important for dopamine homeostasis and neuromodulation (PMID: 25176177). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34358 Product name: Recombinant human SLC10A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 313-437 aa of BC019066 Sequence: ASGYGLATLFHLPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYGTVKAENIIMMETAQTSL Predict reactive species Full Name: solute carrier family 10 (sodium/bile acid cotransporter family), member 4 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC019066 Gene Symbol: SLC10A4 Gene ID (NCBI): 201780 RRID: AB_3669945 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96EP9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924